DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and COX13

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_011324.1 Gene:COX13 / 852684 SGDID:S000003159 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:35/138 - (25%)
Similarity:51/138 - (36%) Gaps:37/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SKCPPKVQPVAETSKNKKKLQSCDELLLGKSTRKQKKPLTAIQGGDLGCPGRTGKKPQIVAQHSK 159
            |..||.....|....:|...|...|.|:  :|.|..|                        ..|.
Yeast    11 SSLPPNALKPAFGPPDKVAAQKFKESLM--ATEKHAK------------------------DTSN 49

  Fly   160 LWQKISLFGVLPMIAILTLLVFSTRSE--EERLEFK---------NYEHMYRRTKRYWFKDGNRT 213
            :|.|||::..||.||:..:..:....|  |.|...|         :||.|..|:|.:::.||::|
Yeast    50 MWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKT 114

  Fly   214 AFHNSHFN 221
            .|.|...|
Yeast   115 LFWNPVVN 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 24/87 (28%)
COX13NP_011324.1 COX6A 3..125 CDD:396573 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.750

Return to query results.
Submit another query.