DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and cox6a1

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001016543.1 Gene:cox6a1 / 549297 XenbaseID:XB-GENE-855918 Length:111 Species:Xenopus tropicalis


Alignment Length:103 Identity:35/103 - (33%)
Similarity:53/103 - (51%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LTAIQGGDLGCPGRTGKKPQIVAQHS---KLWQKISLFGVLPMIAILTLLVF--STRSEEERLEF 192
            |:.|..|.|...||.........:|:   :.|:.::....||.:|:..|..:  ......|..||
 Frog     7 LSGILRGSLPSRGRLFSAAASEQEHAGAVRTWKILTYVVALPGVAVCMLNAYLKMQHHSHENPEF 71

  Fly   193 KNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYED 230
            ..|||:..|||::.:.|||::.|||:|.||| |.|||:
 Frog    72 IPYEHLRIRTKKFPWGDGNKSLFHNAHVNAL-PNGYEE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 28/87 (32%)
cox6a1NP_001016543.1 Cyt_c_Oxidase_VIa 24..107 CDD:238465 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.