DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and cox6a2

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001004680.1 Gene:cox6a2 / 447942 ZFINID:ZDB-GENE-040912-129 Length:103 Species:Danio rerio


Alignment Length:74 Identity:27/74 - (36%)
Similarity:40/74 - (54%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 SKLWQKISLFGVLPMIAILTLLVF--STRSEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHF 220
            ::.|:.:|....||.:::....|:  ......|:.||..|.|:..|||.:.:.|||.:.|||.|.
Zfish    27 ARTWKILSFVLALPGVSVCMANVYLKMQAHSHEQPEFVPYPHLRIRTKPWPWGDGNHSLFHNPHT 91

  Fly   221 NALPPAGYE 229
            ||| |.|||
Zfish    92 NAL-PTGYE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 25/72 (35%)
cox6a2NP_001004680.1 Cyt_c_Oxidase_VIa 15..99 CDD:238465 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594416
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.