powered by:
Protein Alignment CG14077 and cox6a2
DIOPT Version :9
Sequence 1: | NP_001246828.1 |
Gene: | CG14077 / 40066 |
FlyBaseID: | FBgn0036830 |
Length: | 289 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001004680.1 |
Gene: | cox6a2 / 447942 |
ZFINID: | ZDB-GENE-040912-129 |
Length: | 103 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 27/74 - (36%) |
Similarity: | 40/74 - (54%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 SKLWQKISLFGVLPMIAILTLLVF--STRSEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHF 220
::.|:.:|....||.:::....|: ......|:.||..|.|:..|||.:.:.|||.:.|||.|.
Zfish 27 ARTWKILSFVLALPGVSVCMANVYLKMQAHSHEQPEFVPYPHLRIRTKPWPWGDGNHSLFHNPHT 91
Fly 221 NALPPAGYE 229
||| |.|||
Zfish 92 NAL-PTGYE 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170594416 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3469 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1591077at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001528 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11504 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.810 |
|
Return to query results.
Submit another query.