DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and cox6a1

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001005592.1 Gene:cox6a1 / 335774 ZFINID:ZDB-GENE-030131-7715 Length:108 Species:Danio rerio


Alignment Length:117 Identity:38/117 - (32%)
Similarity:57/117 - (48%) Gaps:19/117 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LGKSTRKQKKPLTAIQGGDLGCPGRTGKKPQIVAQH----SKLWQKISLFGVLPMIAILTL-LVF 181
            :|:.::|..|.....|...|.           .|.|    :|.|:.::....||.:|:..| :..
Zfish     4 VGRLSQKLFKSAALTQSRQLS-----------AAAHGENAAKTWKILTFVVALPGVAVCMLNMYL 57

  Fly   182 STRSEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYE--DE 231
            .::...|:.||..|.|:..|:||:.:.|||:|.|||.|.||||. |||  ||
Zfish    58 RSQHHHEQPEFVPYSHLRIRSKRFPWGDGNKTLFHNPHVNALPD-GYEHHDE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 29/87 (33%)
cox6a1NP_001005592.1 Cyt_c_Oxidase_VIa 24..104 CDD:238465 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.