DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and Cox6a1

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_036946.1 Gene:Cox6a1 / 25282 RGDID:2384 Length:111 Species:Rattus norvegicus


Alignment Length:113 Identity:41/113 - (36%)
Similarity:59/113 - (52%) Gaps:17/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LLGKSTRKQKKPLTAIQGGDLGCPGRTGKKPQIVAQHSKLWQKISLFGVLPMIAILTLLVF--ST 183
            |||::..:..:|:::      |..|..|.        :::|:.::.|..||.:.:..|.||  |.
  Rat    14 LLGRALPRVGRPMSS------GAHGEEGS--------ARIWKALTYFVALPGVGVSMLNVFLKSR 64

  Fly   184 RSEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYEDE 231
            ..|.||.||..|.|:..|||.:.:.|||.|.|||.|.|.| |.|||||
  Rat    65 HEEHERPEFVAYPHLRIRTKPFPWGDGNHTLFHNPHMNPL-PTGYEDE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 31/84 (37%)
Cox6a1NP_036946.1 Cyt_c_Oxidase_VIa 24..109 CDD:238465 34/99 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352486
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.