DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and COX6AL

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_725504.1 Gene:COX6AL / 246451 FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster


Alignment Length:87 Identity:37/87 - (42%)
Similarity:50/87 - (57%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GKKPQIVAQHSKLWQKISLFGVLPMIAILTLLVFSTRSEEERLEFKNYEHMYRRTKRYWFKDGNR 212
            |..|   |..:.||::::....||.|.:.....|:.....||..|..||::.|||||:.:.||||
  Fly    10 GNMP---ANTAGLWKRVTFLLALPAIVLCAANAFTGHKHVEREPFAKYEYLRRRTKRFPWGDGNR 71

  Fly   213 TAFHNSHFNALPPAGYEDEVDE 234
            :.|||:..||| |.||||||.|
  Fly    72 SLFHNAEVNAL-PEGYEDEVAE 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 31/80 (39%)
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468838
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D135527at33392
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.