DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and COX6A2

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_005196.1 Gene:COX6A2 / 1339 HGNCID:2279 Length:97 Species:Homo sapiens


Alignment Length:104 Identity:38/104 - (36%)
Similarity:50/104 - (48%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KPLT-----AIQGGDLGCPGRTGKKPQIVAQHSKLWQKISLFGVLPMIAILTLLVFSTRSEEERL 190
            :|||     |.:||..|...||             |:.::....||.:|:.|...:.......|.
Human     6 RPLTRGLASAAKGGHGGAGART-------------WRLLTFVLALPSVALCTFNSYLHSGHRPRP 57

  Fly   191 EFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYE 229
            ||:.|:|:..|||.|.:.|||.|.|||||.|.| |.|||
Human    58 EFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPL-PTGYE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 29/82 (35%)
COX6A2NP_005196.1 Cyt_c_Oxidase_VIa 26..95 CDD:238465 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.