DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14077 and Cox6a1

DIOPT Version :9

Sequence 1:NP_001246828.1 Gene:CG14077 / 40066 FlyBaseID:FBgn0036830 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_031774.2 Gene:Cox6a1 / 12861 MGIID:103099 Length:111 Species:Mus musculus


Alignment Length:112 Identity:39/112 - (34%)
Similarity:57/112 - (50%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LGKSTRKQKKPLTAIQGGDLGCPGRTGKKPQIVAQHSKLWQKISLFGVLPMIAILTLLVF--STR 184
            ||::....::|:::      |..|..|.        :::|:.::.|..||.:.:..|.||  |..
Mouse    15 LGRALPGLRRPMSS------GAHGEEGS--------ARMWKALTYFVALPGVGVSMLNVFLKSRH 65

  Fly   185 SEEERLEFKNYEHMYRRTKRYWFKDGNRTAFHNSHFNALPPAGYEDE 231
            .|.||..|..|.|:..|||.:.:.|||.|.|||.|.|.| |.|||||
Mouse    66 EEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPL-PTGYEDE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14077NP_001246828.1 Cyt_c_Oxidase_VIa 146..229 CDD:238465 30/84 (36%)
Cox6a1NP_031774.2 Cyt_c_Oxidase_VIa 24..109 CDD:238465 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848879
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.750

Return to query results.
Submit another query.