DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75d and GLR2.4

DIOPT Version :9

Sequence 1:NP_649074.2 Gene:Ir75d / 40065 FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_001328410.1 Gene:GLR2.4 / 829299 AraportID:AT4G31710 Length:912 Species:Arabidopsis thaliana


Alignment Length:334 Identity:69/334 - (20%)
Similarity:111/334 - (33%) Gaps:129/334 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 ITYRQDLEG--IVFNSAIVIAFPDLFTNIEDLSLRHI---DTISKVNHRLMLELANRLNMSYNT- 310
            :|:...:.|  |.|..|::.|.|      .|:|.|.|   |...|.|...:  ||||.:....| 
plant   496 LTHETIVTGFCIDFFEAVIQAMP------YDVSHRFIPFGDDDGKTNDTTI--LANRSSYVDFTL 552

  Fly   311 -YQTVNYGWRQPNGSFDGLMGRFQRYELDLAQLAIF----------MRLDRIALVDFVAETYRVR 364
             |.|...|...|      |.....|..|      ||          |.|....:|.||......|
plant   553 PYTTSGVGMVVP------LKDNVARSSL------IFFKPLTPGLWGMTLGSFFVVGFVVWILEHR 605

  Fly   365 AGIMFRQPPLSAVANIFAMPFENDVWVSILMLLIITTVVLVLELFFSPHNHDMSYMDTLNFVWGA 429
            ....|..||...::.:|        |.:..:::            |:|....||:          
plant   606 VNSEFTGPPQYQISTMF--------WFAFSIMV------------FAPRERVMSF---------- 640

  Fly   430 MCQQGFYVEVRNRSARIIVFTTFVAALFLFTSFSANIVALLQSPSDAIQSLSDLGQSPLEIGVQD 494
                         :||::|.|.:...|.|..|::|::.:||.                       
plant   641 -------------TARVVVITWYFIVLVLTQSYTASLSSLLT----------------------- 669

  Fly   495 TQYNKIYFTESTDPVTKNLYHKKIASKGENI-YMRPLLGMEKMRTGLFAYQVELQAGY---QIVS 555
                    |:..:|...::  |.:.:||..: |.|....:.|:|          ::|:   ::| 
plant   670 --------TQQLNPTETSI--KNVLAKGGPVAYQRDSFVLGKLR----------ESGFPESRLV- 713

  Fly   556 DTFSEPEKC 564
             .|:.||||
plant   714 -PFTSPEKC 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>483 CDD:304360 39/195 (20%)
Lig_chan 388..644 CDD:278489 31/181 (17%)
GLR2.4NP_001328410.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.