DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75d and grik1a

DIOPT Version :9

Sequence 1:NP_649074.2 Gene:Ir75d / 40065 FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster
Sequence 2:XP_009303592.1 Gene:grik1a / 798001 ZFINID:ZDB-GENE-030131-6502 Length:919 Species:Danio rerio


Alignment Length:398 Identity:83/398 - (20%)
Similarity:169/398 - (42%) Gaps:48/398 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LMLELANRLNMSYNTYQTVN--YGWRQPNGSFDGLMGRFQRYELDLAQLAIFMRLDRIALVDFVA 358
            |:.||:|.|..:|......:  ||.:...|.::|::.....:..|||...:.:...|..::||..
Zfish   482 LLKELSNILGFTYEVKLVTDGKYGAQNDKGEWNGMVRELIDHIADLAVAPLTITYVREKVIDFSK 546

  Fly   359 ETYRVRAGIMFRQPPLSAVANIFAM--PFENDVWVSILMLLI-ITTVVLVLELF-----FSPH-- 413
            ....:...|::|:|. .....:|:.  |...|:|:.:|:..: ::.|:.|:..|     ::||  
Zfish   547 PFMTLGISILYRKPN-GTNPGVFSFLNPLTPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPC 610

  Fly   414 -------NHDMSYMDTLNFVWGAMCQQGFYVEVRNRSARIIVFTTFVAALFLFTSFSANIVALL- 470
                   .::.:.:::|.|...|:.:||..:..:..|.||:....:...|.:.:|::||:.|.| 
Zfish   611 NPSSEVVENNFTLLNSLWFGVAALMRQGSELMPKALSTRILGGIWWFFTLIIISSYTANLAAFLT 675

  Fly   471 ----QSPSDAIQSLSDLGQSPLEIGVQDTQYNKIYFTESTDPVTKNLYHKKIASKGENIYMRPLL 531
                .||.|:...|:.  |:.:|.|.........:|.:|.....:.::....:.|...:......
Zfish   676 VERMDSPIDSADDLAK--QTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNSKD 738

  Fly   532 GMEKMRTGLFAYQVELQAGYQIVSDTFSEPEKCGLMELEPFQLPMLAIPTRKNFPYKELIR-RQL 595
            |:.::.|..:|..:|..:...|.....:..:..||::.:.:     .:.|....||::.:. ..|
Zfish   739 GITRVLTTDYALLMESTSIEYITQRNCNLTQVGGLIDSKGY-----GVGTPIGSPYRDKVTIAIL 798

  Fly   596 RWQREVSLVNREERKW----IPQKPKCEGGVGGFVSIGITECRYALGIF---GCGAAVSFVLFLF 653
            :.|.|..|...:|:.|    .|::...|....|..:||        |||   ..|..:|..:.:.
Zfish   799 QLQEEGKLHMMKEKWWRGNGCPEEDSKEASALGVENIG--------GIFIVLAAGLVLSVFVAIG 855

  Fly   654 EFIFRHFK 661
            |||::..|
Zfish   856 EFIYKSHK 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>483 CDD:304360 46/207 (22%)
Lig_chan 388..644 CDD:278489 56/283 (20%)
grik1aXP_009303592.1 Periplasmic_Binding_Protein_Type_1 37..432 CDD:299141
ANF_receptor 57..398 CDD:279440
Periplasmic_Binding_Protein_Type_2 446..815 CDD:304360 68/340 (20%)
Lig_chan 577..846 CDD:278489 56/283 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.