DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75d and Gria3

DIOPT Version :10

Sequence 1:NP_649074.2 Gene:Ir75d / 40065 FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_058582.4 Gene:Gria3 / 53623 MGIID:95810 Length:888 Species:Mus musculus


Alignment Length:46 Identity:10/46 - (21%)
Similarity:19/46 - (41%) Gaps:11/46 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FAPAILVTPLGAVSIIISAVL-----------AHIILREKLHIFGI 121
            ||..:.:.....:..|:.|||           :..:|:..||:.|:
Mouse    76 FASLVNILQCDVLLGILGAVLQWAMEPSGGHWSESMLQRVLHLIGM 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>372 CDD:473866
Lig_chan 386..643 CDD:459656
Gria3NP_058582.4 PBP1_iGluR_AMPA_GluR3 29..403 CDD:380610 10/46 (22%)
PBP2_iGluR_AMPA 416..799 CDD:270433
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.