DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75d and Ir92a

DIOPT Version :9

Sequence 1:NP_649074.2 Gene:Ir75d / 40065 FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:266 Identity:59/266 - (22%)
Similarity:104/266 - (39%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 NMSYNTYQTVNYGWRQPNGSFDGLMGRFQRYELDLAQLAIFMRLDRIALVDFVAETYR--VRAGI 367
            ::....|...|:|....|.|.||::|......:::|...|:...|.|      .||..  .|:.:
  Fly   302 HLRVEAYGADNWGGIYDNESSDGMLGDIYEQRVEMAIGCIYNWYDGI------TETSHTIARSSV 360

  Fly   368 MFRQP---PL-SAVANIFAMPFENDVWVSILMLLIITTVVLVLELFFSPH-NHDMSYMDT-LNFV 426
            ....|   || |...||  |||.|..|    ::||.|.|:....|:|..: ::.:.|..| :.|.
  Fly   361 TILGPAPAPLPSWRTNI--MPFNNRAW----LVLISTLVICGTFLYFMKYVSYRLRYSGTQVKFH 419

  Fly   427 WGAMCQQG----FYVEVRNRSA---------RIIVFTTFVAALFLFTSFSANIVALL-----QSP 473
            .....::.    |.:.::..||         |..:.|...|.:.|...:|..:.::|     .:|
  Fly   420 HSRKLEKSMLDIFALFIQQPSAPLSFDRFAPRFFLATILCATITLENIYSGQLKSMLTFPFYSAP 484

  Fly   474 SDAIQSLSDLG---QSPLEIGVQDTQYNKIYFTESTDPVTKNLYHKKIASKGENIYMRPL--LGM 533
            .|.|:..:..|   .:|..|.|...|.:.:    .|:.:....:.....|...|:...|.  .|:
  Fly   485 VDTIEKWAQSGWKWSAPSIIWVHTVQSSDL----ETEQILARNFEVHDYSYLSNVSFMPNYGFGI 545

  Fly   534 EKMRTG 539
            |::.:|
  Fly   546 ERLSSG 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>483 CDD:304360 47/203 (23%)
Lig_chan 388..644 CDD:278489 34/177 (19%)
Ir92aNP_001097845.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.