DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75d and Grin3b

DIOPT Version :9

Sequence 1:NP_649074.2 Gene:Ir75d / 40065 FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_579842.2 Gene:Grin3b / 170796 RGDID:621705 Length:1002 Species:Rattus norvegicus


Alignment Length:417 Identity:79/417 - (18%)
Similarity:143/417 - (34%) Gaps:85/417 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LMLELANRLNMSYNTYQTVN--YGWRQPNGSFDGLMGRFQRYELDLAQLAIFMRLDRIALVDFVA 358
            |:..||..|...:..|...:  ||..: :|.:.||:|........:|..:..:...|..:|||.:
  Rat   483 LLERLAEDLAFDFELYIVGDGKYGALR-DGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTS 546

  Fly   359 ETYRVRAGIMFRQPPLSAVANIFAMPFENDVWVSILMLLIITTVVLVLELFFSPHNHD------- 416
            ..:....|||.|....::....|..|....:||.:...|.:|.:.|.|..:.||:...       
  Rat   547 PFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRG 611

  Fly   417 --MSYMDTLNFVWGAM-----------CQQGFYVEVRNRSARIIVFTTFVAALFLFTSFSANIVA 468
              .||...||..:..:           |..|          |.::....:..|.:.:|::||:.|
  Rat   612 TVFSYSSALNLCYAILFGRTVSSKTPKCPTG----------RFLMNLWAIFCLLVLSSYTANLAA 666

  Fly   469 LLQSPSDAIQSLSDLGQSPLEIGVQDTQYNKI-------YFTESTDPVTKNLYHKKIASKGENIY 526
            ::.. ....:.||.:....|....|..::..:       |...|...:..::......:....:.
  Rat   667 VMVG-DKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVA 730

  Fly   527 M----RPLLGMEKMRTGLFAYQVELQAGYQIVSDTFSEPEKCGLMEL-EPFQLPMLAIPTRKNFP 586
            |    .|.|....|...|..|:|.:.|             .|.|:.: :||.:....|...:|.|
  Rat   731 MLTSDPPKLNAFIMDKSLLDYEVSIDA-------------DCKLLTVGKPFAIEGYGIGLPQNSP 782

  Fly   587 YKELIRRQLRWQREVSLVNREERKWIPQKPKC-----------EGGVGGFVSIGITECRYALGIF 640
            ....:...:...:....::....||....| |           :.||..|..:.:..|      .
  Rat   783 LTSNLSEFISRYKSSGFIDLLHDKWYKMVP-CGKRVFAVTETLQMGVYHFSGLFVLLC------L 840

  Fly   641 GCGAAVSFVLFLFEFIFRHFKQVYRII 667
            |.|:|:  :..|.|.:|      ||::
  Rat   841 GLGSAL--LTSLGEHVF------YRLV 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>483 CDD:304360 43/205 (21%)
Lig_chan 388..644 CDD:278489 50/298 (17%)
Grin3bNP_579842.2 PBP1_iGluR_NMDA_NR3 21..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 414..808 CDD:270438 64/349 (18%)
Lig_chan 576..842 CDD:278489 49/296 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 882..910
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 951..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.