DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75d and Grik5

DIOPT Version :9

Sequence 1:NP_649074.2 Gene:Ir75d / 40065 FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster
Sequence 2:XP_030098003.1 Gene:Grik5 / 14809 MGIID:95818 Length:1003 Species:Mus musculus


Alignment Length:411 Identity:97/411 - (23%)
Similarity:170/411 - (41%) Gaps:80/411 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LMLELANRLNMSYNTYQTVN--YGWRQPNGSFDGLMGR-FQRYELDLAQLAIFMRLDRIALVDF- 356
            ::.|||..|...|......:  ||..:||||:.|::|. ..|.:.|||..|..:..:|..::|| 
Mouse   473 MLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRQKADLAVAAFTITAEREKVIDFS 537

  Fly   357 -------VAETYRVRAGIMFRQPPLSAVANIFAMPFENDVWVSILMLLIITTVVLVLELFFSPHN 414
                   ::..|||..|   |:|...:    |..||...||:.:|:..:..:.||.|....||:.
Mouse   538 KPFMTLGISILYRVHMG---RKPGYFS----FLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYE 595

  Fly   415 ------------HDMSYMDTL-NFVW---GAMCQQGFYVEVRNRSARIIVFTTFVAALFLFTSFS 463
                        |.:....|| |.:|   |...|||..:..|..|.|.:....:...|.:.:|::
Mouse   596 WYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYT 660

  Fly   464 ANIVALL--QSPSDAIQSLSDLG-QSPLEIGVQDTQYNKIYFTESTDPVTKNLYHKKIASKGENI 525
            ||:.|.|  |.....::|..||. |:.:|.|.........:|..|.....:.::: .:.||..::
Mouse   661 ANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWN-YMQSKQPSV 724

  Fly   526 YMRPL-LGMEKMRTGLFAYQVELQAGYQIVSDTFSEPEK---C------GLMELEPFQLPM-LAI 579
            :::.. .|:.::....:|:.:|         .|.:|..:   |      ||::.:.:.:.| |..
Mouse   725 FVKSTEEGIARVLNSRYAFLLE---------STMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGS 780

  Fly   580 PTRKNFPYKELIRRQLRWQREVSLVNREERKW-----IPQKPKCEGGVGGFVSIGITECRYALGI 639
            |.|.......|   ||:....:.::   :|||     .|::........|..:||        ||
Mouse   781 PFRDEITLAIL---QLQENNRLEIL---KRKWWEGGRCPKEEDHRAKGLGMENIG--------GI 831

  Fly   640 FG---CGAAVSFVLFLFEFIF 657
            |.   ||..::..:.:.|||:
Mouse   832 FVVLICGLIIAVFVAVMEFIW 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>483 CDD:304360 58/212 (27%)
Lig_chan 388..644 CDD:278489 63/293 (22%)
Grik5XP_030098003.1 PBP1_iGluR_Kainate_KA1_2 23..424 CDD:380616
Periplasmic_Binding_Protein_Type_2 437..808 CDD:419667 85/357 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846555
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.