DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6841 and UTP6

DIOPT Version :9

Sequence 1:	NP_001303371.1	Gene:	CG6841 / 40064	FlyBaseID:	FBgn0036828	Length:	931	Species:	Drosophila melanogaster
Sequence 2:	NP_010737.1	Gene:	UTP6 / 852060	SGDID:	S000002857	Length:	440	Species:	Saccharomyces cerevisiae

Alignment Length:	139	Identity:	33/139 - (23%)
Similarity:	57/139 - (41%)	Gaps:	26/139 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   649 ERARRLLAKARGSAPTPRVMMKSARLEWALEK---FDEALRLLEEAVEVFPDFPKLWMMKGQIEE 710
            :|.:|:|          :|...::..:|::::   |     :.:.....||...|.|.|  .:..
Yeast    69 KRCKRIL----------QVKKTNSLSDWSIQQRIGF-----IYQRGTNKFPQDLKFWAM--YLNY 116

  Fly   711 QQRRTDDAA-----ATYTLGLKKCPTSIPLWILSANLE-ERKGVLTKARSILERGRLRNPKVAVL 769
            .:.|.:..:     ..|...||..||::.:||..|..| |........|:|.:.|...||.|..|
Yeast   117 MKARGNQTSYKKIHNIYNQLLKLHPTNVDIWISCAKYEYEVHANFKSCRNIFQNGLRFNPDVPKL 181

  Fly   770 WLEAIRVEL 778
            |.|.::.||
Yeast   182 WYEYVKFEL 190

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6841	NP_001303371.1	PRP1_N	22..173	CDD:283962
		TPR repeat	393..419	CDD:276809
		TPR repeat	424..448	CDD:276809
		HAT	434..466	CDD:214642
		TPR repeat	454..481	CDD:276809
		TPR	543..803	CDD:223533	33/139 (24%)
		HAT	546..576	CDD:214642
		TPR repeat	633..660	CDD:276809	3/10 (30%)
		TPR_14	665..708	CDD:290164	8/45 (18%)
		TPR repeat	698..728	CDD:276809	6/34 (18%)
		TPR repeat	733..758	CDD:276809	7/25 (28%)
		TPR repeat	767..795	CDD:276809	5/12 (42%)
UTP6	NP_010737.1	COG5191	1..440	CDD:227518	33/139 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000