DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp6 and BGAL14

DIOPT Version :10

Sequence 1:NP_649073.1 Gene:Prp6 / 40064 FlyBaseID:FBgn0036828 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001154292.1 Gene:BGAL14 / 830016 AraportID:AT4G38590 Length:1052 Species:Arabidopsis thaliana


Alignment Length:151 Identity:64/151 - (42%)
Similarity:92/151 - (60%) Gaps:22/151 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAPPATKRKKKDEEEEEDEDLNDSNYDEFSG 87
            |..||||:||||.||||||||||||...|                     .:.|:| ..:|:|.|
plant   922 PSNYVAGLGRGAAGFTTRSDIGPARANGD---------------------GNADVN-HKFDDFEG 964

  Fly    88 YSGSLFSKDPYDKDDEEADAIYDSIDKRMDEKRKEYRDRRLREDLERYRQERPKIQQQFSDLKRS 152
            :...||:....|..|:|||||:|:||:|||.:||:.|:.:|::::|.||...||:..||.||.|.
plant   965 HDAGLFANAESDDQDKEADAIWDAIDRRMDSRRKDRREAKLKQEIENYRASNPKVSGQFVDLTRK 1029

  Fly   153 LASVTSEEWSTIPEVGDSRNR 173
            |.:::.:||.:|||:|:..:|
plant  1030 LHTLSEDEWDSIPEIGNYSHR 1050

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp6NP_649073.1 PRP1_N 22..173 CDD:461908 63/149 (42%)
PEP_TPR_lipo 236..>800 CDD:274350
TPR repeat 393..419 CDD:276809
TPR repeat 424..448 CDD:276809
TPR repeat 454..481 CDD:276809
LapB 610..861 CDD:442196
TPR repeat 633..660 CDD:276809
TPR repeat 698..728 CDD:276809
TPR repeat 733..758 CDD:276809
TPR repeat 767..795 CDD:276809
BGAL14NP_001154292.1 PLN03059 65..831 CDD:166698
PRP1_N 921..1050 CDD:461908 63/149 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.