DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1b and PCI8

DIOPT Version :9

Sequence 1:NP_524152.2 Gene:CSN1b / 40063 FlyBaseID:FBgn0027057 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_085069.3 Gene:PCI8 / 854739 SGDID:S000001333 Length:444 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:49/267 - (18%)
Similarity:80/267 - (29%) Gaps:88/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 LQQKKYKVAAKHF---------LNANFDHCDFPEMISTSNVAVYGGLCALATFDRQELKRLVIAS 342
            ||::.:....|.|         |....:|.|....||.....:...:..|.:.........:..|
Yeast   184 LQERYFDCCTKFFTMMTSEPLTLKVLSEHLDCMNFISKEEFIMMVNISVLISIPLDNYDDFIYLS 248

  Fly   343 TSFKLFLELEPQLRDIIFKFYESKYASCLTLL-------------DEIRDNLLVDMYIAP----- 389
             ..|.|.::.|.|            .:||.||             .||....:..:::.|     
Yeast   249 -DLKQFFQMTPLL------------VNCLELLINTNFNKFFKIWHGEINKICMESLFLEPSWSSS 300

  Fly   390 -------HVTTLYTKIRNRALIQYFSPYMSADMHKMAMAFNSSVGDLENEVMQLILDGQIQARID 447
                   .:...|.:|..:....|.|..:..|:.           |::.|:.:||:.||:...||
Yeast   301 AAVIMRCKIYFFYLRISKKLQFSYLSSTLGIDLE-----------DIKEELTKLIISGQLNFEID 354

  Fly   448 SH--------------NKILFAKEADQRNSTFERALIMGKQYQRHTRMLVLRAAMLKSHIHVKSI 498
            ..              |:|       .||.|....:| .|....:|.        ||..|....:
Yeast   355 GDVIHFEDSSILQSIVNEI-------SRNGTMINEVI-DKLKNENTD--------LKDIIQGNPL 403

  Fly   499 SREGGSN 505
            ...||:|
Yeast   404 MYSGGNN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN1bNP_524152.2 RPN7 159..338 CDD:287560 10/59 (17%)
PCI 353..457 CDD:279707 24/142 (17%)
PCI8NP_085069.3 PINT 296..387 CDD:214509 19/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103258
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.