DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1b and Rpn7

DIOPT Version :9

Sequence 1:NP_524152.2 Gene:CSN1b / 40063 FlyBaseID:FBgn0027057 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_651048.1 Gene:Rpn7 / 42641 FlyBaseID:FBgn0028688 Length:389 Species:Drosophila melanogaster


Alignment Length:342 Identity:71/342 - (20%)
Similarity:150/342 - (43%) Gaps:29/342 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 VEKDAFAYDAAWVDTKMKK-AALKLEKLDSDLKNYKSNSIKESIRRGHDDLADHYLSCGDLTNAL 214
            |:||..|        :||: ..:::|:||:.:::.:.|..:..:|..:...:::....||...|.
  Fly    65 VDKDLLA--------RMKENNRVEVEQLDAAIEDAEKNLGEMEVREANLKKSEYLCRIGDKAAAE 121

  Fly   215 KCYSRARDYCTSGKHVVNMCLNVIKVSIYLQNWAHVMSYISKAESTPDFAEGSKEANAQVHTRLE 279
            ..:.:..:...|..|.:::..::|::.::..:...:...|.||:..  ..||   .:.....||:
  Fly   122 TAFRKTYEKTVSLGHRLDIVFHLIRLGLFYLDHDLITRNIDKAKYL--IEEG---GDWDRRNRLK 181

  Fly   280 CAAGLAELQQKKYKVAAKHFLN-----ANFDHCDFPEMISTSNVAVYGGLCALATFDRQELKRLV 339
            ...|:..:..:.:|.||..||:     .:::..|:|..:   ...||..:.||   .|.||:..|
  Fly   182 VYQGVYSVAVRDFKAAATFFLDTVSTFTSYELMDYPTFV---RYTVYVAMIAL---PRNELRDKV 240

  Fly   340 IASTSFKLFLELEPQLRDIIFKFYESKYASCLTLLDEIRDNLLVDMYIAPHVTTLYTKIRNRALI 404
            |..:..:..|...|.::..:|..|..:|.:....|..:...|.:|..|.||......::|.....
  Fly   241 IKGSEIQEVLHGLPDVKQFLFSLYNCQYENFYVHLAGVEKQLRLDYLIHPHYRYYVREMRILGYT 305

  Fly   405 QYFSPYMSADMHKMAMAFNSSVGDLENEVMQLILDGQIQARIDSHNKILFAKEADQRNSTFERAL 469
            |....|.|..:..||.:|..:|..::.|:.:.|..|::.|::|....|:.....|.:|..::..:
  Fly   306 QLLESYRSLTLQYMAESFGVTVEYIDQELARFIAAGRLHAKVDRVGGIVETNRPDNKNWQYQATI 370

  Fly   470 IMG----KQYQRHTRML 482
            ..|    .:.|:.:|::
  Fly   371 KQGDLLLNRIQKLSRVI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN1bNP_524152.2 RPN7 159..338 CDD:287560 35/184 (19%)
PCI 353..457 CDD:279707 24/103 (23%)
Rpn7NP_651048.1 RPN7 15..382 CDD:227514 69/335 (21%)
RPN7 66..239 CDD:287560 38/191 (20%)
PCI 254..358 CDD:279707 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.