DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6843 and rp9

DIOPT Version :9

Sequence 1:NP_649072.1 Gene:CG6843 / 40062 FlyBaseID:FBgn0036827 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_017950118.1 Gene:rp9 / 496684 XenbaseID:XB-GENE-944905 Length:234 Species:Xenopus tropicalis


Alignment Length:298 Identity:63/298 - (21%)
Similarity:105/298 - (35%) Gaps:93/298 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PASRDNLKRVWMAEQQAEAYKK---KQEELRNQYEKEQNLHENKAMLSKDSKDKLSVNFMYE-PP 76
            |.|:.::|....:|..|.:...   :.:|..:...|.:....:....|::.|....|...|| ||
 Frog     9 PRSKHSVKHHRRSEDNAVSPGSTCDQDQEQEHSSRKRRRSSSSGTHTSQEIKKIKHVETFYEKPP 73

  Fly    77 PGVRKEREKDDNEPEYKFEWQRKYNAPRESYC----KGDTEIRD-----------QPFGIQVRNV 126
            ||:.||.|                  |:...|    .|:...||           .|.|.:|:.:
 Frog    74 PGLIKEDE------------------PKPEDCIPDLPGNEHARDFLAHAPTRGLWMPLGKEVKVM 120

  Fly   127 RCLKCHKWGHINTDKECTMYSISMSEARKLHAETEASDIMAKNVLEEQMKEDGLMMKRSAQELQS 191
            :|.:|.::||...|:||..:.                                    :..|:::.
 Frog   121 QCWRCKQYGHRTGDRECPYFI------------------------------------KGNQKIEQ 149

  Fly   192 IRAIQQQHQLVPSDGEKDAHADDQNPELVFLKSLSKKQKLKLLKKLEKIERMKRKGE-GIKKPTK 255
            .|.               ||.|   |....:|:...::|........:|:::|:..| .....:.
 Frog   150 FRV---------------AHED---PMYGLIKNKEHEEKQMSHVPYYRIQQLKKLLEDSTSDESS 196

  Fly   256 RKSKKERHEKDSKKKKSKKDKSSRKDKKGSVSNSSDSS 293
            ..|..:.|.| .||||.||||..||.||...|:::.||
 Frog   197 SSSSGDSHGK-HKKKKKKKDKKKRKKKKHKHSHNNSSS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6843NP_649072.1 Cir_N 13..49 CDD:287204 6/35 (17%)
rp9XP_017950118.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.