DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6843 and Rp9

DIOPT Version :9

Sequence 1:NP_649072.1 Gene:CG6843 / 40062 FlyBaseID:FBgn0036827 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_038937642.1 Gene:Rp9 / 363032 RGDID:1559759 Length:211 Species:Rattus norvegicus


Alignment Length:267 Identity:66/267 - (24%)
Similarity:112/267 - (41%) Gaps:73/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QEELRNQYEKEQNLHENKAMLSKDSKDKLSVNFMYEPPPGVRKEREKDDNEPEYKFEWQRKYNAP 103
            :.||:.:.|:::..|:.:.:    .:.|...:|..:||||..||   |:.:||............
  Rat    15 EHELQRRREQKRRRHDAQQL----QQLKHLESFYEKPPPGFIKE---DETKPEDCIPDVPGNEHA 72

  Fly   104 RESYCKGDTEIRDQPFGIQVRNVRCLKCHKWGHINTDKECTMY---SISMSEARKLHAETEASDI 165
            ||......|:....|.|.:|:.::|.:|.::||...||||..:   :..:.:.|..| |....||
  Rat    73 REFLAHAPTKGLWMPLGREVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAH-EDPMYDI 136

  Fly   166 MAKNVLEEQMKEDGLMMKRSAQELQSIRAIQQQHQLVPSDGEKDAHADDQNPELVFLKSLSKKQK 230
            :.:|             ||..::::    |||..||:     :|:.:||..              
  Rat   137 IREN-------------KRHEKDVR----IQQLKQLL-----EDSTSDDDG-------------- 165

  Fly   231 LKLLKKLEKIERMKRKGEGIKKPTKRKSKKERHEKDSKKKKSKKDKSSRKDKKGSVSNSSDSSSS 295
                          ....|.::..|::.|||:|:   |:||.||.|..||.|         :|.|
  Rat   166 --------------SSSSGDREKHKKRKKKEKHK---KRKKEKKKKKKRKHK---------ASKS 204

  Fly   296 SDSSDSE 302
            .:||||:
  Rat   205 HESSDSK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6843NP_649072.1 Cir_N 13..49 CDD:287204 3/9 (33%)
Rp9XP_038937642.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3794
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.