DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and Gtsf1

DIOPT Version :10

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_083073.1 Gene:Gtsf1 / 74174 MGIID:1921424 Length:167 Species:Mus musculus


Alignment Length:98 Identity:32/98 - (32%)
Similarity:51/98 - (52%) Gaps:7/98 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYCPYNKEHKMLRKKLQQHILKCRVIYKDTV-ELMVCPFNSSHLIPEPQFFQHTQSCEDRNII- 63
            ::.|||:|.|::...:...|::|||..:.|.. :|..||||:.|.:|..:...|..||:|::.| 
Mouse    14 LLQCPYDKNHQIRACRFPYHLIKCRKNHPDVANKLATCPFNARHQVPRAEISHHISSCDDKSCIE 78

  Fly    64 --VHYQTS--APAVLSEDTRHAKIESEENWDDD 92
              |..||.  ....|:|.|.... ..:|:||.|
Mouse    79 QDVVNQTRNLGQETLAESTWQCP-PCDEDWDKD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 1..25 CDD:461603 7/23 (30%)
zf-U11-48K 34..58 CDD:461603 9/23 (39%)
Gtsf1NP_083073.1 zf-U11-48K 14..38 CDD:461603 7/23 (30%)
zf-U11-48K 48..71 CDD:461603 8/22 (36%)

Return to query results.
Submit another query.