DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and zgc:56699

DIOPT Version :9

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_997998.1 Gene:zgc:56699 / 405758 ZFINID:ZDB-GENE-040426-2099 Length:182 Species:Danio rerio


Alignment Length:138 Identity:41/138 - (29%)
Similarity:63/138 - (45%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYCPYNKEHKMLRKKLQQHILKCRVIY-KDTVELMVCPFNSSHLIPEPQFFQHTQSCEDR---- 60
            :|.|||:|.|::...:...|:||||..: |...||..||||:.||||:.:...|..:|||:    
Zfish    43 IVQCPYDKNHQIRASRFPFHVLKCRKNHPKLASELKTCPFNARHLIPKHEMSHHIANCEDKRCLN 107

  Fly    61 ----NIIVHYQTSAPAVLSEDTRHAKIESEENWDDDES-----------VPDY--DPQVYCSRAN 108
                |:.|..:...|  ::..|..|..|..|...||.:           :|..  :|....|.::
Zfish   108 AEDGNVEVLEKFQVP--VNTWTNPAPNEDWETETDDNAAMFVWGESTNPLPQNKPEPDTTISLSD 170

  Fly   109 IVREPNGL 116
            .:|.|..|
Zfish   171 GLRAPRTL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 4..25 CDD:283028 8/20 (40%)
zf-U11-48K 35..58 CDD:283028 9/22 (41%)
zgc:56699NP_997998.1 zf-U11-48K 44..67 CDD:283028 9/22 (41%)
zf-U11-48K 78..101 CDD:283028 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24597
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21402
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.