powered by:
Protein Alignment arx and CG14036
DIOPT Version :9
Sequence 1: | NP_649071.1 |
Gene: | arx / 40061 |
FlyBaseID: | FBgn0036826 |
Length: | 167 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608903.1 |
Gene: | CG14036 / 33735 |
FlyBaseID: | FBgn0031677 |
Length: | 93 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 16/55 - (29%) |
Similarity: | 33/55 - (60%) |
Gaps: | 3/55 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 CPYNKEHKMLRKKLQQHILKCRVIYKDTVELMVCPFNSSHLIPEPQFFQHTQSCE 58
|||:|.|::|..::.:|::||...|... .|..|.:|::|.:.:.: :|.:.|:
Fly 9 CPYDKSHRILLFRMPKHLIKCEKNYCGP-PLQTCKYNATHRVQDME--KHLKECD 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4376 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1359124at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5535 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.850 |
|
Return to query results.
Submit another query.