DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and CG14036

DIOPT Version :9

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster


Alignment Length:55 Identity:16/55 - (29%)
Similarity:33/55 - (60%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CPYNKEHKMLRKKLQQHILKCRVIYKDTVELMVCPFNSSHLIPEPQFFQHTQSCE 58
            |||:|.|::|..::.:|::||...|... .|..|.:|::|.:.:.:  :|.:.|:
  Fly     9 CPYDKSHRILLFRMPKHLIKCEKNYCGP-PLQTCKYNATHRVQDME--KHLKECD 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 4..25 CDD:283028 8/20 (40%)
zf-U11-48K 35..58 CDD:283028 4/22 (18%)
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 8/20 (40%)
zf-U11-48K 40..59 CDD:283028 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5535
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.