DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and Gtsf2

DIOPT Version :9

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_808299.1 Gene:Gtsf2 / 223927 MGIID:2652828 Length:154 Species:Mus musculus


Alignment Length:164 Identity:40/164 - (24%)
Similarity:67/164 - (40%) Gaps:35/164 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CPYNKEHKMLRKKLQQHILKCRVIYKDTVELMV-CPFNSSHLIPEPQFFQHTQSCEDRNIIVHYQ 67
            |||:..|::...:||.|:..|:.......:.|. |.:|:.|::|..:..:|..:|.:|..:    
Mouse     9 CPYDPNHRIPASRLQYHLASCKKKNPKIAKKMANCKYNACHVVPIKRLKEHEANCINRTAV---- 69

  Fly    68 TSAPAVLSEDTRHAKIESEENWDDDES-VPDYDPQVYCSRANIVREPNGLFP-------AQRRAF 124
            ...|..|.:.| |...|..||:....| .|  ||.|:    |:....:  ||       |.::..
Mouse    70 DDEPLNLQKIT-HPVFEENENFSSAGSQFP--DPDVW----NVDHAHH--FPSFVLETFAPKKLV 125

  Fly   125 IEQEKRRHFGEDYEEEKKPRKAKARADLRPTPYE 158
            .|.:.|     |.:|        |.||..|..::
Mouse   126 CESDSR-----DLQE--------AMADKHPNSFK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 4..25 CDD:283028 7/20 (35%)
zf-U11-48K 35..58 CDD:283028 6/23 (26%)
Gtsf2NP_808299.1 zf-U11-48K 9..29 CDD:368359 7/19 (37%)
zf-U11-48K 43..63 CDD:368359 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840051
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.