DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and gtsf-1

DIOPT Version :9

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_503000.1 Gene:gtsf-1 / 178471 WormBaseID:WBGene00020286 Length:169 Species:Caenorhabditis elegans


Alignment Length:105 Identity:28/105 - (26%)
Similarity:50/105 - (47%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYCPYNKEHKMLRKKLQQHILKCRV----IYKDTVELMVCPFNSSHLIPEPQFFQHTQSCEDRNI 62
            :.||||.:||:..::...|:.|||.    .|..:::|..|.:|..|.:||.:...|...|:.::.
 Worm    19 ITCPYNSDHKVSMEEFNTHLWKCRTEKLHFYPHSLKLKRCSYNMRHFLPEEELQFHEIFCKRQSA 83

  Fly    63 IVHYQTSAPAV---LSEDTRHAKIESEENWDDDESVPDYD 99
            .:..|.|...:   ::|.....|:..|.. .|:||:...|
 Worm    84 DLRRQLSLEPLELNVAEHLAAQKLRKEYE-KDEESLDGSD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 4..25 CDD:283028 8/20 (40%)
zf-U11-48K 35..58 CDD:283028 6/22 (27%)
gtsf-1NP_503000.1 zf-U11-48K 19..42 CDD:368359 8/22 (36%)
zf-U11-48K 56..79 CDD:368359 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 1 1.000 - - FOG0006729
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.