DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and GTSF1

DIOPT Version :9

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_653195.2 Gene:GTSF1 / 121355 HGNCID:26565 Length:167 Species:Homo sapiens


Alignment Length:98 Identity:33/98 - (33%)
Similarity:52/98 - (53%) Gaps:7/98 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYCPYNKEHKMLRKKLQQHILKCRVIYKDTV-ELMVCPFNSSHLIPEPQFFQHTQSCEDRNII- 63
            ::.|||:|.|::...:...|::|||..:.|.. :|..||||:.|.:|..:...|..||:||:.| 
Human    14 LLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIE 78

  Fly    64 --VHYQTSA--PAVLSEDTRHAKIESEENWDDD 92
              |..||.:  ...|:|.|.... ..:|:||.|
Human    79 QDVVNQTRSLRQETLAESTWQCP-PCDEDWDKD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 4..25 CDD:283028 7/20 (35%)
zf-U11-48K 35..58 CDD:283028 8/22 (36%)
GTSF1NP_653195.2 zf-U11-48K 15..38 CDD:398771 7/22 (32%)
zf-U11-48K 49..71 CDD:398771 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5387
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40293
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21402
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.