DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arx and LOC100535654

DIOPT Version :9

Sequence 1:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_017212607.1 Gene:LOC100535654 / 100535654 -ID:- Length:179 Species:Danio rerio


Alignment Length:103 Identity:26/103 - (25%)
Similarity:50/103 - (48%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYCPYNKEHKMLRKKLQQHILKCRVIYKDTV-ELMVCPFNSSHLIPEPQFFQHTQSCEDRNIIV 64
            ::.|||:..|.:...:...|::|||..:.:.| ||..||||:.||:.:.:...|..:|.||..:.
Zfish    29 LLLCPYDPHHLIRACRFPYHLIKCRKNHPELVGELWTCPFNARHLMKKNELSHHISTCVDRCSVT 93

  Fly    65 HYQTSAPAVLSEDTRHAKIE----------SEENWDDD 92
            .      ..:::|...:|.:          .:|:||::
Zfish    94 E------TYVAKDKTDSKFQIPVSTWTAPVCDEDWDEE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arxNP_649071.1 zf-U11-48K 4..25 CDD:283028 6/20 (30%)
zf-U11-48K 35..58 CDD:283028 7/22 (32%)
LOC100535654XP_017212607.1 zf-U11-48K 32..53 CDD:283028 6/20 (30%)
zf-U11-48K 65..86 CDD:283028 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24597
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.