DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL26 and RPL26B

DIOPT Version :9

Sequence 1:NP_001262025.1 Gene:RpL26 / 40060 FlyBaseID:FBgn0036825 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_011548.2 Gene:RPL26B / 852922 SGDID:S000003266 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:126 Identity:72/126 - (57%)
Similarity:95/126 - (75%) Gaps:2/126 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRRDDEVQVIRGHFKGNQ 66
            ||:..|||.|||.||.:|.|||..||.|:|||||||||.:|.::::||||||||.|:||..|| |
Yeast     3 KQSLDVSSDRRKARKAYFTAPSSERRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVRGSKKG-Q 66

  Fly    67 VGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIHPSKVLIVKLKLDKDRKAILERRGKGRL 127
            .||:...||.||.|.|:|:.:|..||.:|.:.:||||::|.||.|||||||:::|:| |:|
Yeast    67 EGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHPSKLVITKLHLDKDRKALIQRKG-GKL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL26NP_001262025.1 Ribosomal_L26 8..122 CDD:407140 65/113 (58%)
RPL26BNP_011548.2 Ribosomal_L26 9..122 CDD:407140 65/113 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345374
Domainoid 1 1.000 134 1.000 Domainoid score I1094
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H113207
Inparanoid 1 1.050 139 1.000 Inparanoid score I1190
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62197
OrthoFinder 1 1.000 - - FOG0001919
OrthoInspector 1 1.000 - - otm46854
orthoMCL 1 0.900 - - OOG6_100790
Panther 1 1.100 - - LDO PTHR11143
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5688
SonicParanoid 1 1.000 - - X1273
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.