DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL26 and AT3G49910

DIOPT Version :9

Sequence 1:NP_001262025.1 Gene:RpL26 / 40060 FlyBaseID:FBgn0036825 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_190560.1 Gene:AT3G49910 / 824153 AraportID:AT3G49910 Length:146 Species:Arabidopsis thaliana


Alignment Length:148 Identity:94/148 - (63%)
Similarity:118/148 - (79%) Gaps:3/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRRDDEVQVIRGHFKGN 65
            ||.||.|:||||||||.||.|.|..||.:||:|||.:|||||||||||||:|||||::||.:||.
plant     1 MKYNPRVTSSRRKNRKAHFTASSSERRVIMSSPLSTDLRQKYNVRSMPIRKDDEVQIVRGTYKGR 65

  Fly    66 QVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIHPSKVLIVKLKLDKDRKAILERRGKGRLAAL 130
            : |||||.||:|:|:::|:|.||..|||.|.|||.||||:|.||:||||||::|||:.||| ||.
plant    66 E-GKVVQVYRRKWVIHIERITREKVNGTTVNVGIQPSKVVITKLRLDKDRKSLLERKAKGR-AAA 128

  Fly   131 GKDKG-KYTEETAAQPME 147
            .|:|| |:|.|...|.::
plant   129 DKEKGTKFTSEDVMQNVD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL26NP_001262025.1 Ribosomal_L26 8..122 CDD:407140 76/113 (67%)
AT3G49910NP_190560.1 Ribosomal_L26 8..121 CDD:407140 76/113 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 158 1.000 Domainoid score I1296
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H113207
Inparanoid 1 1.050 181 1.000 Inparanoid score I1451
OMA 1 1.010 - - QHG62197
OrthoDB 1 1.010 - - D1488916at2759
OrthoFinder 1 1.000 - - FOG0001919
OrthoInspector 1 1.000 - - otm2613
orthoMCL 1 0.900 - - OOG6_100790
Panther 1 1.100 - - O PTHR11143
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1273
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.