DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL26 and RPL26

DIOPT Version :9

Sequence 1:NP_001262025.1 Gene:RpL26 / 40060 FlyBaseID:FBgn0036825 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_000978.1 Gene:RPL26 / 6154 HGNCID:10327 Length:145 Species:Homo sapiens


Alignment Length:147 Identity:107/147 - (72%)
Similarity:127/147 - (86%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRRDDEVQVIRGHFKGN 65
            ||.||||:|.|.|||||||.|||||||::||:||||||||||||||||||:||||||:|||:||.
Human     1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQ 65

  Fly    66 QVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIHPSKVLIVKLKLDKDRKAILERRGKGRLAAL 130
            |:|||||.||||:|:|:|::|||.||||.|:||||||||:|.:||||||||.||||:.|.|  .:
Human    66 QIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSR--QV 128

  Fly   131 GKDKGKYTEETAAQPME 147
            ||:||||.|||..:..|
Human   129 GKEKGKYKEETIEKMQE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL26NP_001262025.1 Ribosomal_L26 8..122 CDD:407140 88/113 (78%)
RPL26NP_000978.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 15/19 (79%)
Ribosomal_L26 8..122 CDD:407140 88/113 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..145 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155525
Domainoid 1 1.000 195 1.000 Domainoid score I3152
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H113207
Inparanoid 1 1.050 225 1.000 Inparanoid score I3510
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62197
OrthoDB 1 1.010 - - D1488916at2759
OrthoFinder 1 1.000 - - FOG0001919
OrthoInspector 1 1.000 - - otm41642
orthoMCL 1 0.900 - - OOG6_100790
Panther 1 1.100 - - LDO PTHR11143
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5688
SonicParanoid 1 1.000 - - X1273
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.