DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL26 and mrpl24

DIOPT Version :9

Sequence 1:NP_001262025.1 Gene:RpL26 / 40060 FlyBaseID:FBgn0036825 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001007638.1 Gene:mrpl24 / 295224 RGDID:1359289 Length:216 Species:Rattus norvegicus


Alignment Length:123 Identity:34/123 - (27%)
Similarity:50/123 - (40%) Gaps:38/123 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRRDDEVQVIRGHFKGNQVGKVVQA 73
            :.:|||      .|...||.::..|:|.|        ...:...|.|:::.|...|.| |||||.
  Rat    30 ADKRKN------PPWSRRRPVVVEPISDE--------DWHLFCGDMVEILEGKDAGKQ-GKVVQV 79

  Fly    74 YRKKFVVYVEKIQRENANGTNV---YVG--------IHPSKVLI----VKLKLDKDRK 116
            .|::..|.:|        |.|.   |:|        :.||:..:    |||....|||
  Rat    80 VRQRNWVVLE--------GLNTHYRYIGRTKDHRGTMIPSEAPLLHHQVKLVDPVDRK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL26NP_001262025.1 Ribosomal_L26 8..122 CDD:407140 34/123 (28%)
mrpl24NP_001007638.1 KOW 59..154 CDD:294253 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.