DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL26 and rpl26

DIOPT Version :9

Sequence 1:NP_001262025.1 Gene:RpL26 / 40060 FlyBaseID:FBgn0036825 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_595654.1 Gene:rpl26 / 2540274 PomBaseID:SPBC29B5.03c Length:126 Species:Schizosaccharomyces pombe


Alignment Length:123 Identity:72/123 - (58%)
Similarity:94/123 - (76%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRRDDEVQVIRGHFKGN 65
            ||.:..|:|||||.||.||.|||.:||.|||||||||||::|.:||:|:||||::.||||..||.
pombe     1 MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVRRDDQITVIRGSNKGR 65

  Fly    66 QVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIHPSKVLIVKLKLDKDRKAILERRG 123
            : ||:...|||||::.:|::.||.|||.:..|||..|||:|.||.||||||.::.|:|
pombe    66 E-GKITSVYRKKFLLLIERVTREKANGASAPVGIDASKVVITKLHLDKDRKDLIVRKG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL26NP_001262025.1 Ribosomal_L26 8..122 CDD:407140 67/113 (59%)
rpl26NP_595654.1 Ribosomal_L26 8..121 CDD:293511 67/113 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1217
eggNOG 1 0.900 - - E1_COG0198
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H113207
Inparanoid 1 1.050 145 1.000 Inparanoid score I1336
OMA 1 1.010 - - QHG62197
OrthoFinder 1 1.000 - - FOG0001919
OrthoInspector 1 1.000 - - oto101555
orthoMCL 1 0.900 - - OOG6_100790
Panther 1 1.100 - - LDO PTHR11143
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5688
SonicParanoid 1 1.000 - - X1273
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.