DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL26 and rpl26

DIOPT Version :10

Sequence 1:NP_649070.1 Gene:RpL26 / 40060 FlyBaseID:FBgn0036825 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_595654.1 Gene:rpl26 / 2540274 PomBaseID:SPBC29B5.03C Length:126 Species:Schizosaccharomyces pombe


Alignment Length:123 Identity:72/123 - (58%)
Similarity:94/123 - (76%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRRDDEVQVIRGHFKGN 65
            ||.:..|:|||||.||.||.|||.:||.|||||||||||::|.:||:|:||||::.||||..||.
pombe     1 MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVRRDDQITVIRGSNKGR 65

  Fly    66 QVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIHPSKVLIVKLKLDKDRKAILERRG 123
            : ||:...|||||::.:|::.||.|||.:..|||..|||:|.||.||||||.::.|:|
pombe    66 E-GKITSVYRKKFLLLIERVTREKANGASAPVGIDASKVVITKLHLDKDRKDLIVRKG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL26NP_649070.1 Ribosomal_L26 8..122 CDD:465307 67/113 (59%)
rpl26NP_595654.1 Ribosomal_L26 8..121 CDD:465307 67/113 (59%)

Return to query results.
Submit another query.