DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and Acox2

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001155139.1 Gene:Acox2 / 93732 MGIID:1934852 Length:681 Species:Mus musculus


Alignment Length:271 Identity:65/271 - (23%)
Similarity:110/271 - (40%) Gaps:59/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DPAVAAF--VDIHNTLVNSLMIKFGNAEQKAKYLPKLAQEY--AGSFALTEPGAGSDAFSLKTVA 172
            |..:|.:  :::|...:|::. ..|:.||.||: .:|.:.:  ..::|.||.|.|:....|:|.|
Mouse   107 DRVLAGYNNLNLHGIAMNAIR-SLGSDEQIAKW-GQLGKNFQIITTYAQTELGHGTYLQGLETEA 169

  Fly   173 KKDGS--HYVINGS-----KMW-------ISNSDVAGVFLIFANAKPEDGYRGITTFIVDRET-- 221
            ..|.:  .:||:..     |.|       :::: |....||...|:     .|:..|||...:  
Mouse   170 TYDATTQEFVIHSPTMTSIKWWPGDLGRTVTHA-VVLAHLICLGAR-----HGMHAFIVPIRSLE 228

  Fly   222 -----PGLIVNKPEDKLGIRASGTCQLTFDNVRVPEENILGTFGHGYKYAAGFLNEGRIGIAAQM 281
                 ||:.|.....|:|........|..::||||.||:|..|       |..|.:|    ..|.
Mouse   229 DHTPLPGITVGDIGPKMGFENIDNGFLRLNHVRVPRENMLSRF-------AEVLPDG----TYQR 282

  Fly   282 VGLAQGTFDATIPYLLERKQFGDAIY-NFQSMQHQIATVATEIEAARLMTYNAARLQEQGVPFQK 345
            :|..|..:   :..|:.|.|.   :| .|.....:..|:|        :.|...|.|.:..|...
Mouse   283 LGTPQSNY---LGMLVTRVQL---LYKGFLPTLQKACTIA--------VRYAVIRHQSRLRPSDP 333

  Fly   346 EAAMAKYYASE 356
            ||.:.:|...:
Mouse   334 EAKILEYQTQQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 65/271 (24%)
SCAD_SBCAD 39..410 CDD:173847 65/271 (24%)
Acox2NP_001155139.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AXO 20..655 CDD:173839 65/271 (24%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.