DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and Acox3

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_445791.2 Gene:Acox3 / 83522 RGDID:69245 Length:700 Species:Rattus norvegicus


Alignment Length:394 Identity:101/394 - (25%)
Similarity:156/394 - (39%) Gaps:85/394 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KAVFENGLMGIEIDTELGGSGCNFMTN----IVVVEELSKIDPAVAAFVDIHNTLVNSLMIKFGN 135
            |.|||.|....|          :.:.|    :|::..|...|.::|....:|..:..|.:|..| 
  Rat    83 KRVFEYGFFNAE----------DMLKNPLKILVLMNCLGMYDWSLANKCVLHMLVFGSTIIGSG- 136

  Fly   136 AEQKAKYLPKLAQ-EYAGSFALTEPGAGSDAFSLKTVAKKDGS--HYVIN-----GSKMWISN-S 191
            :|...|||.|:.. |..|.|||||...||:..:::|.|..|.:  .::::     .:|.|:.| .
  Rat   137 SEHHFKYLEKIYNLEIFGCFALTELSHGSNTKAMRTTAHYDPATQEFILHSPDFEAAKFWVGNLG 201

  Fly   192 DVAGVFLIFANAKPEDGY-RGITTFIV---DRET----PGLIVNKPEDKLGIRASGTCQLTFDNV 248
            ..|...::||.....||. ||:.:|:|   |.:|    ||::|.....|||..........|..|
  Rat   202 KTATHAVVFAQLYTPDGQCRGLHSFLVQIRDPKTLLPMPGVMVGDMGKKLGQNGLDNGFAMFHKV 266

  Fly   249 RVPEENIL---------GTFGHGYK-------YAAGFLNEGRIG-IAAQMVGLAQGTFDATIPYL 296
            |:|.:|:|         ||:...:|       .:.|.|:.|||. |:..:|.|......| |.:.
  Rat   267 RIPRQNLLDRTGNVTSEGTYNTPFKDVRQRLGASLGSLSSGRISIISISVVNLKLAVIIA-IRFS 330

  Fly   297 LERKQFGDAIYNFQSMQHQIATVATEIEAARLMTYNAA--------------------------- 334
            ..|:|||      .:.:.:|..:...::..||:.|.||                           
  Rat   331 ATRRQFG------PTDKEEIPVLEYPLQQWRLLPYLAAAYALDHFSKTIFLDLIELQRGRQSGDH 389

  Fly   335 --RLQEQGVPFQKEAAMAKYYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYRDVKIGAIYEGTT 397
              |..|.|......|:..|..||..|||...:|.:..||.|:.......:...|......|||..
  Rat   390 SDRQAELGREIHALASAGKPLASWTAQRGIQECREACGGHGYLAMNRFGELRNDNDPNCTYEGDN 454

  Fly   398 NMQL 401
            |:.|
  Rat   455 NVLL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 101/394 (26%)
SCAD_SBCAD 39..410 CDD:173847 101/394 (26%)
Acox3NP_445791.2 AXO 19..672 CDD:173839 101/394 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.