DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and ACOX2

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_003491.1 Gene:ACOX2 / 8309 HGNCID:120 Length:681 Species:Homo sapiens


Alignment Length:355 Identity:78/355 - (21%)
Similarity:137/355 - (38%) Gaps:76/355 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VDIHNTLVNSLMIKFGNAEQKAKYLPKLAQ-EYAGSFALTEPGAGSDAFSLKTVAKKDGS--HYV 180
            ::||...|.:|. ..|:.||.||:.|.... :...::|.||.|.|:....|:|.|..|.:  .:|
Human   116 LNIHRVFVRALR-SLGSEEQIAKWDPLCKNIQIIATYAQTELGHGTYLQGLETEATYDAATQEFV 179

  Fly   181 IN-----GSKMW---ISNSDVAGVF---LIFANAKPEDGYRGITTFIVDRET-------PGLIVN 227
            |:     .:|.|   :..|....:.   ||.:.|:     ||:..|||...:       ||:|:.
Human   180 IHSPTLTATKWWPGDLGRSATHALVQAQLICSGAR-----RGMHAFIVPIRSLQDHTPLPGIIIG 239

  Fly   228 KPEDKLGIRASGTCQLTFDNVRVPEENILGTFGHGYKYAAGFLNEG---RIG------------- 276
            ....|:....:....|..::||||.||:|..|       |..|.:|   ::|             
Human   240 DIGPKMDFDQTDNGFLQLNHVRVPRENMLSRF-------AQVLPDGTYVKLGTAQSNYLPMVVVR 297

  Fly   277 ---IAAQMVGLAQGTFDATIPYLLERKQF----GD---AIYNFQSMQHQI-----ATVATEIEAA 326
               ::.:::.:.|......:.|.:.|:|.    .|   .:.::|:.|.::     .:.|....|.
Human   298 VELLSGEILPILQKACVIAMRYSVIRRQSRLRPSDPEAKVLDYQTQQQKLFPQLAISYAFHFLAV 362

  Fly   327 RLM-----TYNAARLQEQGVPFQKE----AAMAKYYASEVAQRAAIKCVDWMGGVGFTRDFPQEK 382
            .|:     :|.|  :..|...|..|    :...|...||...:.|..|....||.|:::......
Human   363 SLLEFFQHSYTA--ILNQDFSFLPELHALSTGMKAMMSEFCTQGAEMCRRACGGHGYSKLSGLPS 425

  Fly   383 YYRDVKIGAIYEGTTNMQLSTIAKCIKKDY 412
            ....:.....|||...:....:|:.:.|.|
Human   426 LVTKLSASCTYEGENTVLYLQVARFLVKSY 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 78/355 (22%)
SCAD_SBCAD 39..410 CDD:173847 76/351 (22%)
ACOX2NP_003491.1 ACAD 20..655 CDD:324545 78/355 (22%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.