DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and ACX1

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_567513.4 Gene:ACX1 / 827381 AraportID:AT4G16760 Length:664 Species:Arabidopsis thaliana


Alignment Length:451 Identity:96/451 - (21%)
Similarity:147/451 - (32%) Gaps:166/451 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AFVDIHNTLVNSLMIKFGNAEQKAKYLPKLA--QEYAGSFALTEPGAGSDAFSLKTVAKKD--GS 177
            |:||:|..:....:...|..||:.|:| .||  .:..|.:|.||.|.||:...|:|.|..|  ..
plant    97 AYVDLHWGMFVPAIKGQGTEEQQKKWL-SLANKMQIIGCYAQTELGHGSNVQGLETTATFDPKTD 160

  Fly   178 HYVIN-----GSKMW------ISNSDVAGVFLIFANAKPEDGYRGITTFIVDRET-------PGL 224
            .:||:     .||.|      :|...|....|| .|.|.    .||..|||...:       |.:
plant   161 EFVIHTPTQTASKWWPGGLGKVSTHAVVYARLI-TNGKD----YGIHGFIVQLRSLEDHSPLPNI 220

  Fly   225 IVNKPEDKLGIRASGTCQ---LTFDNVRVPEENIL-----------------------GT----- 258
            .|.....|:|..|..:..   |.||:||:|.:.:|                       ||     
plant   221 TVGDIGTKMGNGAYNSMDNGFLMFDHVRIPRDQMLMRLSKVTREGEYVPSDVPKQLVYGTMVYVR 285

  Fly   259 ---------------------------FG-HG---------YK-------------YAAGFLNE- 272
                                       || |.         ||             ||..|:.| 
plant   286 QTIVADASNALSRAVCIATRYSAVRRQFGAHNGGIETQVIDYKTQQNRLFPLLASAYAFRFVGEW 350

  Fly   273 ---------GRIGIA---------AQMVGLAQGTFDATIPYLLE-RKQFGD-------------A 305
                     .|:..:         |...||...|..||...:.| ||..|.             |
plant   351 LKWLYTDVTERLAASDFATLPEAHACTAGLKSLTTTATADGIEECRKLCGGHGYLWCSGLPELFA 415

  Fly   306 IYNFQSMQHQIATVATEIEAARLMTYNAARLQEQGVPFQKEAAMAKYYASEVAQ-RAAI-KCVDW 368
            :| ..:..::...|..:::.||.:....|:|....||....|.|.:  |:.:.| |:.: |..||
plant   416 VY-VPACTYEGDNVVLQLQVARFLMKTVAQLGSGKVPVGTTAYMGR--AAHLLQCRSGVQKAEDW 477

  Fly   369 MG-------------------GVGFTRDFPQEKYYRDVKIGAIYEGTTNMQLSTIAKCIKK 410
            :.                   ....::...||:.::::....:.....:.||..::|.|.|
plant   478 LNPDVVLEAFEARALRMAVTCAKNLSKFENQEQGFQELLADLVEAAIAHCQLIVVSKFIAK 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 96/451 (21%)
SCAD_SBCAD 39..410 CDD:173847 95/449 (21%)
ACX1NP_567513.4 PLN02443 1..664 CDD:178062 96/451 (21%)
ACAD 6..635 CDD:299127 96/451 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.