DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and AT3G06690

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_187325.4 Gene:AT3G06690 / 819854 AraportID:AT3G06690 Length:187 Species:Arabidopsis thaliana


Alignment Length:76 Identity:15/76 - (19%)
Similarity:30/76 - (39%) Gaps:15/76 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LPPPLT-------------FLTDDEKMMKETVAKLAQEQIQPLVKKMDF--EHKFDPSVVKAVFE 79
            ||..||             |...:..:::...:::||.|.:...::..|  .|:....:.||..|
plant    23 LPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTE 87

  Fly    80 NGLMGIEIDTE 90
            ..::...:|.|
plant    88 KAMLQTILDAE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 10/56 (18%)
SCAD_SBCAD 39..410 CDD:173847 10/54 (19%)
AT3G06690NP_187325.4 ACOX 49..182 CDD:280012 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.