DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and ACX5

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_181112.1 Gene:ACX5 / 818138 AraportID:AT2G35690 Length:664 Species:Arabidopsis thaliana


Alignment Length:312 Identity:73/312 - (23%)
Similarity:117/312 - (37%) Gaps:60/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 FVDIHNTLVNSLMIKFGNAEQKAKYLPKLA--QEYAGSFALTEPGAGSDAFSLKTVAKKD--GSH 178
            |:|:|..:....:...|..:|:.|:| .||  .:..|.:|.||.|.||:...|:|.|..|  ...
plant    98 FLDLHWGMFVPAIKGQGTEQQQQKWL-SLATKMQIIGCYAQTELGHGSNVQGLETTATFDPKTDQ 161

  Fly   179 YVIN-----GSKMWISN-SDVAGVFLIFANAKPEDGYRGITTFIVDRET-------PGLIVNKPE 230
            ::|:     .||.|... ..|:...:|:|.........|:..|||...:       ||:.|....
plant   162 FIIHSPTQTSSKWWPGGLGKVSTHAVIYARLITNGKDHGVHGFIVQLRSLDDHSPLPGITVGDIG 226

  Fly   231 DKLGIRASGTCQ---LTFDNVRVPEENILGTFG----HGYKYAAG------------FLNEGRIG 276
            .|.|..|..:..   |.||:.|:|.:.:|....    .| ||.|.            ::.:..:.
plant   227 MKFGNGAYNSMDNGFLMFDHFRIPRDQMLMRLSKVTREG-KYVASDVPRQLVYGTMVYVRQSIVS 290

  Fly   277 IAAQMVGLAQGTFDATIPYLLERKQFGD-------AIYNFQSMQHQIATVATEIEAAR------- 327
            .|:  ..||:....|| .|...|:|||.       .:.|:::.|:::..:.....|.|       
plant   291 NAS--TALARAVCIAT-RYSAVRRQFGSHDGGIETQVINYKTQQNRLFPLLASAYAFRFVGEWLK 352

  Fly   328 -LMTYNAARLQEQGVPFQKEA----AMAKYYASEVAQRAAIKCVDWMGGVGF 374
             |.|....||:........||    |..|...:........:|....||.|:
plant   353 WLYTDVTKRLEASDFATLPEAHACTAGLKSMTTSATSDGIEECRKLCGGHGY 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 73/312 (23%)
SCAD_SBCAD 39..410 CDD:173847 73/312 (23%)
ACX5NP_181112.1 PLN02443 1..664 CDD:178062 73/312 (23%)
ACAD 6..635 CDD:299127 73/312 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.