powered by:
Protein Alignment CG3902 and pes1
DIOPT Version :9
Sequence 1: | NP_649069.2 |
Gene: | CG3902 / 40059 |
FlyBaseID: | FBgn0036824 |
Length: | 414 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_989410.1 |
Gene: | pes1 / 395049 |
XenbaseID: | XB-GENE-480670 |
Length: | 581 |
Species: | Xenopus tropicalis |
Alignment Length: | 34 |
Identity: | 9/34 - (26%) |
Similarity: | 16/34 - (47%) |
Gaps: | 4/34 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 352 YYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYR 385
||.:::..:. |.|:....|:.|.|.:..||
Frog 189 YYQADILGQT----VTWITPYAFSHDHPTDVDYR 218
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1960 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.