DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and pes1

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_989410.1 Gene:pes1 / 395049 XenbaseID:XB-GENE-480670 Length:581 Species:Xenopus tropicalis


Alignment Length:34 Identity:9/34 - (26%)
Similarity:16/34 - (47%) Gaps:4/34 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 YYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYR 385
            ||.:::..:.    |.|:....|:.|.|.:..||
 Frog   189 YYQADILGQT----VTWITPYAFSHDHPTDVDYR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 9/34 (26%)
SCAD_SBCAD 39..410 CDD:173847 9/34 (26%)
pes1NP_989410.1 NOP7 6..564 CDD:227492 9/34 (26%)
Pescadillo_N 9..279 CDD:284208 9/34 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..321
BRCT_2 330..415 CDD:293197
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.