DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and CG17544

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster


Alignment Length:368 Identity:90/368 - (24%)
Similarity:141/368 - (38%) Gaps:91/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 EELSKIDPAVAAFVDIHNTLVNSLMIKFGNAEQKAKYLPKL-AQEYAGSFALTEPGAGSDAFSLK 169
            |.|:...|:::..:.:...|.|:.:...| .|:..||:... .:|.....|:||...||:..|::
  Fly   108 EALACYSPSLSVKIALGVGLFNNAIRAMG-TEKHQKYIEAAWNREVITCLAITELSHGSNTKSIR 171

  Fly   170 TVAKKDGS--HYVIN-----GSKMWISN-SDVAGVFLIFANAKPEDGY-RGITTFIV---DRET- 221
            |.|..|.:  .:|||     .:|.|:.| ...|.|.:.|||....||. .|:..|::   |.:| 
  Fly   172 TTATYDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMTFANLYTADGQNHGLHGFLIPIRDPKTL 236

  Fly   222 ---PGLIVNKPEDKLGIRASGTCQLTFDNVRVPEENIL---------GTF-------GHGYKYAA 267
               ||::|....:|.|:.......:.|.|.|:|.:|:|         |.:       |.....|.
  Fly   237 LSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGAAL 301

  Fly   268 GFLNEGRIGIAAQMVGLAQGTFDATIPYLLERKQFGD-------AIYNFQSMQHQI--------- 316
            ...:.|||||..:............:.|...|||||.       ||..:|..|::|         
  Fly   302 ESFSAGRIGIMQESANTLCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQYRIFPYLAAACV 366

  Fly   317 ATVATE------IE-AAR---------LMTYNAARLQEQGVPFQKEAAMAKYYASEVAQRAAIKC 365
            ..:|||      :| .||         ::|.|||.:.   ........:..:.|.:..|.|...|
  Fly   367 QKIATEELTSTYMEIIARSQADSNGFDVLTQNAAEIH---ALISSSKPLITWAARDAIQEAREAC 428

  Fly   366 VDWMGGVGFTRDFPQEKYYRDVKIGAI---------YEGTTNM 399
                ||.|         |.:..|:|.:         |||..|:
  Fly   429 ----GGHG---------YLQAAKLGQMRTDHDPLCTYEGDNNV 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 90/368 (24%)
SCAD_SBCAD 39..410 CDD:173847 90/368 (24%)
CG17544NP_001163015.1 AXO 16..670 CDD:173839 90/368 (24%)
PLN02443 18..687 CDD:178062 90/368 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.