DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and Acox2

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_665713.2 Gene:Acox2 / 252898 RGDID:628684 Length:681 Species:Rattus norvegicus


Alignment Length:351 Identity:79/351 - (22%)
Similarity:131/351 - (37%) Gaps:68/351 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VDIHNTLVNSLMIKFGNAEQKAKYLPKLAQEY--AGSFALTEPGAGSDAFSLKTVAKKDGS--HY 179
            :.:|...:|::. ..|:.||.||: .:|.:.:  ..::|.||.|.|:....|:|.|..|.:  .:
  Rat   116 LSLHGVAMNAIR-SLGSDEQIAKW-GQLCKNFQIITTYAQTELGHGTYLQGLETEATYDEARQEF 178

  Fly   180 VIN-----GSKMW-------ISNSDVAGVFLIFANAKPEDGYR-GITTFIVDRET-------PGL 224
            ||:     .:|.|       ::::.|.......       |.| |:..|||...:       ||:
  Rat   179 VIHSPTMTSTKWWPGDLGWSVTHAVVLAQLTCL-------GVRHGMHAFIVPIRSLEDHTPLPGI 236

  Fly   225 IVNKPEDKLGIRASGTCQLTFDNVRVPEENILGTFGH----GYKYAAGFLNEGRIGIAAQMV--- 282
            .|.....|:|:.......|..::||||.||:|..|..    |.....|......:|:....|   
  Rat   237 TVGDIGPKMGLEHIDNGFLQLNHVRVPRENMLSRFAEVLPDGTYQRLGTPQSNYLGMLVTRVQLL 301

  Fly   283 ------GLAQGTFDATIPYLLERKQF----GD---AIYNFQSMQH----QIAT------VATEIE 324
                  .|.:....|| .|.:.|.|.    .|   .|..:|:.|.    |:|.      .||.:.
  Rat   302 CKGILPSLQKACIIAT-RYSVIRHQSRLRPSDPEAKILEYQTQQQKLLPQLAVSYAFHFTATSLS 365

  Fly   325 AARLMTYNAARLQEQGVPFQKEA---AMAKYYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYRD 386
            .....:|:|...::..:..:..|   .|...:|...||.|.| |....||.|:::..........
  Rat   366 EFFHSSYSAILKRDFSLLPELHALSTGMKATFADFCAQGAEI-CRRACGGHGYSKLSGLPTLVAR 429

  Fly   387 VKIGAIYEGTTNMQLSTIAKCIKKDY 412
            ......|||...:....:|:.:.|.|
  Rat   430 ATASCTYEGENTVLYLQVARFLMKSY 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 79/351 (23%)
SCAD_SBCAD 39..410 CDD:173847 77/347 (22%)
Acox2NP_665713.2 AXO 20..655 CDD:173839 79/351 (23%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.