DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3902 and vps53

DIOPT Version :9

Sequence 1:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_002934389.2 Gene:vps53 / 100496110 XenbaseID:XB-GENE-1011610 Length:830 Species:Xenopus tropicalis


Alignment Length:203 Identity:46/203 - (22%)
Similarity:75/203 - (36%) Gaps:74/203 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SSATGLPPPLTFLTDDEKMMKETVAKLAQEQI-----------------QPLVKKMDFEHKFDPS 72
            ||::||  .:|.|..:::  ...|||...|::                 |.|.:|:  :.|.|.:
 Frog   521 SSSSGL--TITSLLKEKE--GSEVAKFTPEELCLICSILSTAEYCLATTQQLEEKL--KEKVDLT 579

  Fly    73 VVKAVFENGLMGIEIDTELGGSGCNFMTNI-----VVVEEL-SKIDPAVAAF----------VDI 121
            :.:.:...|    |:||        |.|.|     ::|::| |..|||:.|.          |..
 Frog   580 LTERINLTG----EMDT--------FSTVISNSIQLLVQDLDSSCDPALIAMSKMQWQNVEHVGD 632

  Fly   122 HNTLVNSLMIKF--------GNAEQKAKYLPKLAQEYAGSF------------ALTEPGAGS--- 163
            .:..|.|::...        .|.....||..:...::|.||            .::..||..   
 Frog   633 QSPYVTSIIFHIKQSVPIIRDNLASTRKYFTQFCIKFANSFIPKFINHLFKCKPISMVGAEQLLL 697

  Fly   164 DAFSLKTV 171
            |..|||||
 Frog   698 DTHSLKTV 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3902NP_649069.2 CaiA 37..414 CDD:224871 41/191 (21%)
SCAD_SBCAD 39..410 CDD:173847 40/189 (21%)
vps53XP_002934389.2 Vps53_N 38..452 CDD:282020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.