DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijB and ninj1

DIOPT Version :9

Sequence 1:NP_649068.1 Gene:NijB / 40057 FlyBaseID:FBgn0036822 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001008021.2 Gene:ninj1 / 493383 XenbaseID:XB-GENE-959247 Length:146 Species:Xenopus tropicalis


Alignment Length:109 Identity:40/109 - (36%)
Similarity:65/109 - (59%) Gaps:19/109 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NSYAANKNVAEGLMDIALLSANANQLRFLITYNDKASTYIYSMIMVILSLVLQLLVGIMLIFKRR 139
            |.||..|:|||.::|:|||.|||:|::.:|......|.|:..::::.:|.|||::||::|||..:
 Frog    34 NHYANKKSVAESMLDVALLMANASQMKAVIDQGPSFSYYVPLLVLISISFVLQVIVGVLLIFIVK 98

  Fly   140 LKRFRNRSYERTN-------DLL---VMG-VFMITVINILLAAF 172
                    |:..|       |:|   ..| ||:|.|:|:|:.||
 Frog    99 --------YDLNNPAKHYILDILENTATGLVFIIVVVNVLVTAF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijBNP_649068.1 Ninjurin 75..172 CDD:282740 38/107 (36%)
ninj1NP_001008021.2 Ninjurin 34..134 CDD:368193 38/107 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.