DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijB and NINJ2

DIOPT Version :9

Sequence 1:NP_649068.1 Gene:NijB / 40057 FlyBaseID:FBgn0036822 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_057617.3 Gene:NINJ2 / 4815 HGNCID:7825 Length:142 Species:Homo sapiens


Alignment Length:136 Identity:41/136 - (30%)
Similarity:73/136 - (53%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ESKKSN---KKCSSDLSTE----NSYAANKNVAEGLMDIALLSANANQLRFLITYNDKASTYIYS 116
            ||.:.|   :..|||..::    |.||..|:|||.::|:||..:||.:|:.::.....:..|...
Human     2 ESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSSHYYTTL 66

  Fly   117 MIMVILSLVLQLLVGIMLIFKRRL------KRFRNRSYERTNDLLVMGVFMITVINILLAAFTTT 175
            :.::.|||:||:::|::|:...||      |::|   ..:.|:...:.||...|||:.:.||   
Human    67 VTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWR---LNQLNNAATILVFFTVVINVFITAF--- 125

  Fly   176 DGGGSH 181
               |:|
Human   126 ---GAH 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijBNP_649068.1 Ninjurin 75..172 CDD:282740 31/102 (30%)
NINJ2NP_057617.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7594
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.