DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijB and NINJ1

DIOPT Version :9

Sequence 1:NP_649068.1 Gene:NijB / 40057 FlyBaseID:FBgn0036822 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_004139.2 Gene:NINJ1 / 4814 HGNCID:7824 Length:152 Species:Homo sapiens


Alignment Length:104 Identity:38/104 - (36%)
Similarity:65/104 - (62%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NSYAANKNVAEGLMDIALLSANANQLRFLITYNDKASTYIYSMIMVILSLVLQLLVGIMLIFKRR 139
            |.||:.|:.||.::|||||.|||:||:.::......:.|:..::::.:|||||:.||::|||   
Human    39 NHYASKKSAAESMLDIALLMANASQLKAVVEQGPSFAFYVPLVVLISISLVLQIGVGVLLIF--- 100

  Fly   140 LKRF------RNRSYERTNDLLVMGVFMITVINILLAAF 172
            |.::      ::...:..|:|....||:|.|:||.:.||
Human   101 LVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijBNP_649068.1 Ninjurin 75..172 CDD:282740 36/102 (35%)
NINJ1NP_004139.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
N-terminal adhesion motif. /evidence=ECO:0000269|PubMed:33028854 26..37
Ninjurin 39..139 CDD:309864 36/102 (35%)
Required to induce plasma membrane rupture. /evidence=ECO:0000250|UniProtKB:O70131 40..69 15/28 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.