DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and GRX6

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_010274.1 Gene:GRX6 / 851551 SGDID:S000002168 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:33/108 - (30%)
Similarity:52/108 - (48%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFK---KLNVDATIIELDGNPDGNEI 71
            |.|:|:|              .::||||:.|.|....||..:   :...:..|||||.:..|.|:
Yeast   120 SLILDLS--------------PIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEEL 170

  Fly    72 QAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGALQKYFQ 114
            |..:..:||..|||.:.::|...||..:||::...|.|.:..|
Yeast   171 QEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 28/82 (34%)
GRX6NP_010274.1 GRX_GRXh_1_2_like 127..210 CDD:239511 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1344
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 1 1.100 - - O PTHR45694
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.720

Return to query results.
Submit another query.