DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and AT1G03020

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_171801.1 Gene:AT1G03020 / 839505 AraportID:AT1G03020 Length:102 Species:Arabidopsis thaliana


Alignment Length:78 Identity:27/78 - (34%)
Similarity:38/78 - (48%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELDGNPDGNEIQAVLGEITGARTVPRV 87
            :.|.:....|||||||.|......|........::|:.|||...:|.||:..|.|:....|||.|
plant     4 ISNLLEDKPVVIFSKTSCCMSHSIKSLISGYGANSTVYELDEMSNGPEIERALVELGCKPTVPAV 68

  Fly    88 FIDGKFIGGGTDI 100
            ||..:.:||...:
plant    69 FIGQELVGGANQL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 26/70 (37%)
AT1G03020NP_171801.1 GlrX-like_plant 4..101 CDD:274023 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.