DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and GRXC1

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_568962.1 Gene:GRXC1 / 836423 AraportID:AT5G63030 Length:125 Species:Arabidopsis thaliana


Alignment Length:123 Identity:46/123 - (37%)
Similarity:63/123 - (51%) Gaps:19/123 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAVGSALRSPIVDMSTKQAKFVEN----TIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIE 61
            ||::.|..|     ||.::.:.|.|    .:::..||:||||||.||...|:...:|.....::|
plant     1 MGSMFSGNR-----MSKEEMEVVVNKAKEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLE 60

  Fly    62 LDGNPDGNEIQAVLGEITGARTVPRVFIDGKFIGG----------GTDIKRMFETGAL 109
            ||...||.|||:.|.|.||..|||.|||.|..|||          |..:..:.|.||:
plant    61 LDEMSDGGEIQSALSEWTGQTTVPNVFIKGNHIGGCDRVMETNKQGKLVPLLTEAGAI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 38/89 (43%)
GRXC1NP_568962.1 GRX_GRXh_1_2_like 30..111 CDD:239511 35/80 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53522
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X228
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.