DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and GrxC5

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_194602.2 Gene:GrxC5 / 828994 AraportID:AT4G28730 Length:174 Species:Arabidopsis thaliana


Alignment Length:111 Identity:45/111 - (40%)
Similarity:63/111 - (56%) Gaps:1/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELDG- 64
            |.:..||..|......::..:.:..|:..|.|||:|||:|.|||..|..||:|.|...::|||. 
plant    51 MTSSSSAASSSSSSFGSRMEESIRKTVTENTVVIYSKTWCSYCTEVKTLFKRLGVQPLVVELDQL 115

  Fly    65 NPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGALQ 110
            .|.|.::|.||..:||..|||.||:.||.|||.||..::...|.|:
plant   116 GPQGPQLQKVLERLTGQHTVPNVFVCGKHIGGCTDTVKLNRKGDLE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 39/81 (48%)
GrxC5NP_194602.2 GRX_GRXh_1_2_like 82..161 CDD:239511 38/78 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 1 1.000 - - FOG0000858
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100315
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X228
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.