DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1 and AT3G62950

DIOPT Version :9

Sequence 1:NP_001246827.1 Gene:Grx1 / 40053 FlyBaseID:FBgn0036820 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_191854.1 Gene:AT3G62950 / 825470 AraportID:AT3G62950 Length:103 Species:Arabidopsis thaliana


Alignment Length:101 Identity:33/101 - (32%)
Similarity:51/101 - (50%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELDGNPDGNEIQAVLG 76
            |.|:|:|:|           .|||:|:.|..|...|..|.:|.....|.|||.:|:|.|::..|.
plant     4 IRDLSSKKA-----------AVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALR 57

  Fly    77 EITGAR-TVPRVFIDGKFIGGGTDIKRMFETGALQK 111
            .:..:. .||.||:.|::||...||......|:|::
plant    58 ALGSSNPAVPAVFVGGRYIGSAKDIISFHVDGSLKQ 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1NP_001246827.1 GRX_GRXh_1_2_like 31..111 CDD:239511 28/80 (35%)
AT3G62950NP_191854.1 GlrX-like_plant 4..103 CDD:274023 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535999at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.